Recombinant Human SMAP1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SMAP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-440 of Human SMAP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SMAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMAP1 Protein

  • FLJ13159
  • FLJ42245
  • small ArfGAP 1
  • SMAP-1
  • stromal membrane-associated GTPase-activating protein 1
  • stromal membrane-associated protein 1

Background

The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
5140-SM
Species: Hu
NBP1-80737
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KO
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-32630
Species: Hu
Applications: IHC, IHC-P
NBP2-38375
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
AF5599
Species: Mu
Applications: WB, IHC
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP1-83992
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for SMAP1 Recombinant Protein (H00060682-P01) (0)

There are no publications for SMAP1 Recombinant Protein (H00060682-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMAP1 Recombinant Protein (H00060682-P01) (0)

There are no reviews for SMAP1 Recombinant Protein (H00060682-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMAP1 Recombinant Protein (H00060682-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SMAP1 Recombinant Protein (H00060682-P01)

Discover related pathways, diseases and genes to SMAP1 Recombinant Protein (H00060682-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMAP1 Recombinant Protein (H00060682-P01)

Discover more about diseases related to SMAP1 Recombinant Protein (H00060682-P01).
 

Pathways for SMAP1 Recombinant Protein (H00060682-P01)

View related products by pathway.

PTMs for SMAP1 Recombinant Protein (H00060682-P01)

Learn more about PTMs related to SMAP1 Recombinant Protein (H00060682-P01).

Blogs on SMAP1

There are no specific blogs for SMAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
SMAP1 Antibody
NBP1-83702

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAP1