SLU7 Antibody (1D3-4A10)

Images

 
There are currently no images for SLU7 Antibody (H00010569-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D3-4A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLU7 Antibody (1D3-4A10) Summary

Immunogen
SLU7 (AAH10634, 1 a.a. ~ 587 a.a) full length recombinant protein with GST tag.MSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQ RKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH QRPQPEKQKQFSSSGEWYKRGVKENSVITKYRKGACENCGAM THKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLMFDYDGKRD RWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGKLV EQANSPKHQWGEEEPNSQTEKDHNSEDEDEDKYAD
Localization
Nucleus. Cytoplasm. Note=Predominantly nuclear. Shuttling between the nucleus and the cytoplasm is regulated by the CCHC-type zinc finger. Upon UV-C stress stimulus, the nuclear concentration of the protein decreases, affecting alternative splicing.
Specificity
SLU7 - step II splicing factor SLU7
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLU7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLU7 Antibody (1D3-4A10)

  • hSlu7
  • MGC9280
  • pre-mRNA-splicing factor SLU7,9G8
  • SLU7 splicing factor homolog (S. cerevisiae)
  • splicing factor
  • step II splicing factor SLU7
  • zinc knuckle motif containing

Background

Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is a splicing factor that has been found to be essential during the second catalytic step in the pre-mRNA splicing process. It associates with the spliceosome and contains a zinc knuckle motif that is found in other splicing factors and is involved in protein-nucleic acid and protein-protein interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58541
Species: Hu
Applications: ICC/IF
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-81801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92692
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
H00055254-P01
Species: Hu
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87275
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010569-M01
Species: Hu
Applications: WB, ELISA

Publications for SLU7 Antibody (H00010569-M01) (0)

There are no publications for SLU7 Antibody (H00010569-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLU7 Antibody (H00010569-M01) (0)

There are no reviews for SLU7 Antibody (H00010569-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLU7 Antibody (H00010569-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLU7 Products

Bioinformatics Tool for SLU7 Antibody (H00010569-M01)

Discover related pathways, diseases and genes to SLU7 Antibody (H00010569-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLU7 Antibody (H00010569-M01)

Discover more about diseases related to SLU7 Antibody (H00010569-M01).
 

Pathways for SLU7 Antibody (H00010569-M01)

View related products by pathway.

PTMs for SLU7 Antibody (H00010569-M01)

Learn more about PTMs related to SLU7 Antibody (H00010569-M01).

Blogs on SLU7

There are no specific blogs for SLU7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLU7 Antibody (1D3-4A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLU7
Entrez
OMIM
Uniprot