SLCO5A1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLCO5A1. Peptide sequence: NMTFLFVSLSYTAESAIVTAFITFIPKFIESQFGIPASNASIYTGVIIVP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLCO5A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for SLCO5A1 Antibody - BSA Free
Background
Solute carrier family 21/O (SLC21/SLCO) is a group of organic anion transporters, which facilitate Na+-independent transport of organic anions and cations, including bile acids, steroid conjugates, and thyroid hormones. SLCO5A1/SLC21A15, also known as OATP5A1, has been detected at the transcriptional level in various human tissues such as those of the brain, skeletal muscle, kidney, and pancreas. Multiple transcript variants of the gene encoding OATP5A1 that are generated by alternative splicing have been registered. Substrates of the OATP5A1 transporter remain unknown.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for SLCO5A1 Antibody (NBP2-83559) (0)
There are no publications for SLCO5A1 Antibody (NBP2-83559).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLCO5A1 Antibody (NBP2-83559) (0)
There are no reviews for SLCO5A1 Antibody (NBP2-83559).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLCO5A1 Antibody (NBP2-83559) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLCO5A1 Products
Blogs on SLCO5A1