Recombinant Human SLCO2A1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLCO2A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 276-325 of Human SLCO2A1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FFFPRAMPIGAKRAPATADEARKLEEAKSRGSLVDFIKRFPCIFLRLLMN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLCO2A1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLCO2A1 Protein

  • OATP2A1member 2
  • PGTmatrin F/G 1
  • Prostaglandin transporter
  • Solute carrier family 21 member 2
  • solute carrier organic anion transporter family member 2A1
  • solute carrier organic anion transporter family, member 2A1

Background

SLCO2A1 - solute carrier organic anion transporter family, member 2A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-179
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-56965
Species: Hu
Applications: WB, ICC/IF
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80977
Species: Hu
Applications: IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
H00006578-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SLCO2A1 Partial Recombinant Protein (H00006578-Q01) (0)

There are no publications for SLCO2A1 Partial Recombinant Protein (H00006578-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLCO2A1 Partial Recombinant Protein (H00006578-Q01) (0)

There are no reviews for SLCO2A1 Partial Recombinant Protein (H00006578-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLCO2A1 Partial Recombinant Protein (H00006578-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLCO2A1 Products

Bioinformatics Tool for SLCO2A1 Partial Recombinant Protein (H00006578-Q01)

Discover related pathways, diseases and genes to SLCO2A1 Partial Recombinant Protein (H00006578-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLCO2A1 Partial Recombinant Protein (H00006578-Q01)

Discover more about diseases related to SLCO2A1 Partial Recombinant Protein (H00006578-Q01).
 

Pathways for SLCO2A1 Partial Recombinant Protein (H00006578-Q01)

View related products by pathway.

PTMs for SLCO2A1 Partial Recombinant Protein (H00006578-Q01)

Learn more about PTMs related to SLCO2A1 Partial Recombinant Protein (H00006578-Q01).

Blogs on SLCO2A1

There are no specific blogs for SLCO2A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLCO2A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO2A1