SLC7A14 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC7A14 Antibody [NBP2-13346] Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC7A14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLGDNEMLIGKSDKSTYNV NHPNYGTVDMTTGIEADESENIYLIKLKKLIGPHYYTMRIRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC7A14 Protein (NBP2-13346PEP)
Publications
Read Publication using NBP2-13346.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24670872)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC7A14 Antibody

  • FLJ37228
  • KIAA1613Solute carrier family 7 member 14
  • probable cationic amino acid transporter
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47607
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13608
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80878
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79801
Species: Hu
Applications: WB
AF4885
Species: Mu
Applications: WB, IP
NBP1-81254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8508
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-76488
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
NBP1-81224
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-51841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84164
Species: Hu
Applications: IHC, IHC-P
NBP2-14511
Species: Hu
Applications: WB, IHC, IHC-P
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P

Publications for SLC7A14 Antibody (NBP2-13346)(1)


Reviews for SLC7A14 Antibody (NBP2-13346) (0)

There are no reviews for SLC7A14 Antibody (NBP2-13346). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC7A14 Antibody (NBP2-13346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC7A14 Products

Bioinformatics Tool for SLC7A14 Antibody (NBP2-13346)

Discover related pathways, diseases and genes to SLC7A14 Antibody (NBP2-13346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A14 Antibody (NBP2-13346)

Discover more about diseases related to SLC7A14 Antibody (NBP2-13346).
 

Pathways for SLC7A14 Antibody (NBP2-13346)

View related products by pathway.

Blogs on SLC7A14

There are no specific blogs for SLC7A14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A14