We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter Protein [H00006532-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Order Details


    • Catalog Number
      H00006532-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-630 of Human SLC6A4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SLC6A4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
96.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter GST (N-Term) Protein

  • 5HT transporter
  • 5-HT Transporter
  • 5-HTT
  • 5HTTLPR
  • 5-HTTLPR
  • hSERT
  • HTT5-hydroxytryptamine transporter
  • Na+/Cl- dependent serotonin transporter
  • OCD1
  • Serotonin Transporter 1
  • SERT
  • SLC6A4
  • sodium-dependent serotonin transporter
  • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR
  • Solute carrier family 6 member 4,5HTT

Background

This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-52071
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
DBD00
Species: Hu
Applications: ELISA
NBP2-15954
Species: Hu, Rt
Applications: IHC,  IHC-P, KO, WB
NBP3-16332
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NLS3921
Species: Hu, Pm, Pm
Applications: IHC,  IHC-P
NBP2-21590
Species: Hu, Mu
Applications: ICC/IF, Simple Western, WB
NBP2-67580
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-16043
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB110-68123
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC,  IHC-P, WB
NB100-74555
Species: Hu, Mu, Pm, Rb, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
H00006999-B01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
H00006532-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01) (0)

There are no publications for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01) (0)

There are no reviews for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC6A4/5-HTTLPR/Serotonin transporter Products

Research Areas for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01)

Find related products by research area.

Blogs on SLC6A4/5-HTTLPR/Serotonin transporter.

Epigenetics of Depression: How Can Psychological Stress Alter Your DNA?
By Emily Cartwright, PhDHow Can Psychological Stress Alter Your DNA? Traumatic events, work demands, relationship conflicts, and health problems are all examples of psychological stressors that can result in phy...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A4