Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter Protein

Images

 
SDS-Page: Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter Protein [H00006532-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-630 of Human SLC6A4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV

Protein/Peptide Type
Recombinant Protein
Gene
SLC6A4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter Protein

  • 5HT transporter
  • 5-HT Transporter
  • 5-HTT
  • 5HTTLPR
  • 5-HTTLPR
  • hSERT
  • HTT5-hydroxytryptamine transporter
  • Na+/Cl- dependent serotonin transporter
  • OCD1
  • Serotonin Transporter 1
  • SERT
  • SLC6A4
  • sodium-dependent serotonin transporter
  • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR
  • Solute carrier family 6 member 4,5HTT

Background

This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-60120
Species: Hu
Applications: WB, TCS
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
H00001815-R02
Species: Hu
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5276
Species: Hu
Applications: WB, IHC
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74555
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-45995
Species: Hu
Applications: WB, IHC
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready

Publications for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01) (0)

There are no publications for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01) (0)

There are no reviews for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC6A4/5-HTTLPR/Serotonin transporter Products

Bioinformatics Tool for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01)

Discover related pathways, diseases and genes to SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01)

Discover more about diseases related to SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01).
 

Pathways for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01)

View related products by pathway.

PTMs for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01)

Learn more about PTMs related to SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01).
 

Research Areas for SLC6A4/5-HTTLPR/Serotonin transporter Recombinant Protein (H00006532-P01)

Find related products by research area.

Blogs on SLC6A4/5-HTTLPR/Serotonin transporter

There are no specific blogs for SLC6A4/5-HTTLPR/Serotonin transporter, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC6A4/5-HTTLPR/Serotonin transporter Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A4
Entrez