SLC4A4 Recombinant Protein Antigen

Images

 
There are currently no images for SLC4A4 Protein (NBP2-32020PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC4A4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC4A4.

Source: E. coli

Amino Acid Sequence: KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC4A4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32020.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC4A4 Recombinant Protein Antigen

  • electrogenic sodium bicarbonate cotransporter 1
  • hhNMC
  • HNBC1
  • KNBC
  • kNBC1
  • Na(+)/HCO3(-) cotransporter
  • NBC
  • NBC1DKFZp781H1314
  • NBC2
  • NBCE1
  • pNBC
  • SLC4A5
  • sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas)
  • Sodium bicarbonate cotransporter
  • Solute carrier family 4 member 4
  • solute carrier family 4, sodium bicarbonate cotransporter, member 4
  • solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type
  • solute carrier family 4, sodium bicarbonate cotransporter, member 5

Background

SLC4A4 - solute carrier family 4, sodium bicarbonate cotransporter, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87850
Species: Hu
Applications:  IHC-P
NB600-919
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-82574
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PAGE
H00009498-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC,  IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF2414
Species: Mu
Applications: IHC, IP, Simple Western, WB
NBP1-90225
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-82594
Species: Hu
Applications: IHC,  IHC-P
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF1936
Species: Hu
Applications: IP, WB
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-13340
Species: Hu
Applications: IHC,  IHC-P
NBP1-83093
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for SLC4A4 Protein (NBP2-32020PEP) (0)

There are no publications for SLC4A4 Protein (NBP2-32020PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC4A4 Protein (NBP2-32020PEP) (0)

There are no reviews for SLC4A4 Protein (NBP2-32020PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC4A4 Protein (NBP2-32020PEP). (Showing 1 - 1 of 1 FAQ).

  1. Have any of your SLC4A4 antibodies been tested for use in IHC?
    • The SLC4A4 antibodies have not been tested, or validated in IHC at this time. We will guarantee all listed applications and species. Should you wish to test in this new application, we would recommend our <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>. Under the terms of this program, you are eligible for a full credit of the price of this antibody in exchange for your data on IHC use. Eligibility for the credit is regardless of positive or negative results, as the data is still useful.

Additional SLC4A4 Products

Array NBP2-32020PEP

Research Areas for SLC4A4 Protein (NBP2-32020PEP)

Find related products by research area.

Blogs on SLC4A4

There are no specific blogs for SLC4A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC4A4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC4A4