SLC39A4/ZIP4 Antibody - BSA Free

Western Blot: SLC39A4/ZIP4 Antibody [NBP2-82345] - Host: Rabbit. Target Name: SLC39A4. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC39A4/ZIP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC39A4/ZIP4 Antibody - BSA Free (NBP2-82345) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC39A4. Peptide sequence: LSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNSSSVWDTVCLSA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC39A4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 66 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC39A4/ZIP4 Antibody - BSA Free

• acrodermatitis enteropathica, zinc-deficiency type
• AEZ
• FLJ20327
• MGC74741
• SLC39A4
• solute carrier family 39 (zinc transporter), member 4
• Solute carrier family 39 member 4
• zinc transporter ZIP4
• ZIP4
• ZIP-4
• ZIP4AEZ
• Zrt- and Irt-like protein 4

Background

SLC39A4/ZIP4 is a gene that codes for a protein that plays a role as a zinc transporter in cellular zinc homeostasis and has two isoforms, with lengths of 647 and 622 amino acids and weights of approximately 68 and 66 kDa respectively. Current research is being done on several diseases and disorders related to this gene including enteropathica, autosomal recessive disease, mental disorders, alopecia, diarrhea, dermatitis, pancreatic cancer, pancreatitis, and carcinoma. SLC39A$/ZIP4 has also been shown to be incvolved in pathways such as the senescence and autophagy, metal ion SLC transporters, and mineral absorption pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC39A4