SLC39A4/ZIP4 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit SLC39A4/ZIP4 Antibody - BSA Free (NBP2-82345) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC39A4. Peptide sequence: LSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNSSSVWDTVCLSA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC39A4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
66 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for SLC39A4/ZIP4 Antibody - BSA Free
Background
SLC39A4/ZIP4 is a gene that codes for a protein that plays a role as a zinc transporter in cellular zinc homeostasis and has two isoforms, with lengths of 647 and 622 amino acids and weights of approximately 68 and 66 kDa respectively. Current research is being done on several diseases and disorders related to this gene including enteropathica, autosomal recessive disease, mental disorders, alopecia, diarrhea, dermatitis, pancreatic cancer, pancreatitis, and carcinoma. SLC39A$/ZIP4 has also been shown to be incvolved in pathways such as the senescence and autophagy, metal ion SLC transporters, and mineral absorption pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Publications for SLC39A4/ZIP4 Antibody (NBP2-82345) (0)
There are no publications for SLC39A4/ZIP4 Antibody (NBP2-82345).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC39A4/ZIP4 Antibody (NBP2-82345) (0)
There are no reviews for SLC39A4/ZIP4 Antibody (NBP2-82345).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC39A4/ZIP4 Antibody (NBP2-82345) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC39A4/ZIP4 Products
Research Areas for SLC39A4/ZIP4 Antibody (NBP2-82345)
Find related products by research area.
|
Blogs on SLC39A4/ZIP4