SLC39A14 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091] - Analysis in human liver and tonsil tissues using Anti-SLC39A14 antibody. Corresponding SLC39A14 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: SLC39A14 Antibody [NBP3-17091] - Staining of human tonsil shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC39A14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC39A14 Antibody - BSA Free (NBP3-17091) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC39A14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC39A14 Antibody - BSA Free

• Irt-like protein 14
• LIV-1 subfamily of ZIP zinc transporter 4
• LZT-Hs4
• solute carrier family 39 (metal ion transporter), member 14
• solute carrier family 39 (zinc transporter), member 14
• solute carrier family 39 member 14
• zinc transporter ZIP14
• ZIP14
• ZIP-14
• zrt- and Irt-like protein 14

Background

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A14 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 (PubMed 12659941)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC39A14