SLC39A13 Antibody (2G2) - Azide and BSA Free

Sandwich ELISA: SLC39A13 Antibody (2G2) [H00091252-M03] - Detection limit for recombinant GST tagged SLC39A13 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 2G2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC39A13 Antibody (2G2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SLC39A13 Antibody (2G2) - Azide and BSA Free (H00091252-M03) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SLC39A13 (NP_689477.2, 170 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANT
• Specificity: Reacts with solute carrier family 39 (zinc transporter), member 13.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC39A13
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC39A13 Antibody (2G2) - Azide and BSA Free

• FLJ25785
• LIV-1 subfamily of ZIP zinc transporter 9
• LZT-Hs9
• solute carrier family 39 (metal ion transporter), member 13
• solute carrier family 39 (zinc transporter), member 13
• Solute carrier family 39 member 13
• zinc transporter ZIP13
• ZIP13
• ZIP-13
• Zrt- and Irt-like protein 13

Background

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A13 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC39A13
• Entrez:
  • 91252(Human)
• Uniprot:
  • NP_689477(Human)