SLC30A5 Antibody

Product Discontinued

SLC30A5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSPSKRGQKGTLIGYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEESDSRQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC30A5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC30A5 Antibody

• FLJ12756
• MGC5499
• solute carrier family 30 (zinc transporter), member 5
• zinc transporter 5
• zinc transporter ZTL1
• ZnT-5FLJ12496
• ZNT5Solute carrier family 30 member 5
• ZNTL1hZTL1
• ZTL1ZnT-like transporter 1

Background

SLC30A5 functions as a zinc transporter. May be a transporter of zinc into beta cells in order to form insulin crystals. Partly regulates cellular zinc homeostasis. Required with ZNT7 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Tra

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC30A5