SLC25A26 Antibody - BSA Free

Western Blot: SLC25A26 Antibody [NBP2-83544] - Host: Rabbit. Target Name: SLC25A26. Sample Type: Lung Tumor lysates. Antibody Dilution: 1.0ug/ml

Western Blot: SLC25A26 Antibody [NBP2-83544] - Host: Rabbit. Target: SLC25A26. Positive control (+): Human Liver (LI). Negative control (-): 293T Cell Lysate (2T). Antibody concentration: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC25A26 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC25A26. Peptide sequence: VDLILFPLDTIKTRLQSPQGFNKAGGFHGIYAGVPSAAIGSFPNAAAFFI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A26
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC25A26 Antibody - BSA Free

• FLJ77340
• member 26
• mitochondrial S-adenosylmethionine transporter
• S-adenosylmethionine mitochondrial carrier protein
• SAMC
• solute carrier family 25, member 26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A26