SLC25A25 Antibody - BSA Free

Western Blot: SLC25A25 Antibody [NBP2-88290] - Host: Rabbit. Target Name: Slc25a25. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC25A25 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC25A25 Antibody - BSA Free (NBP2-88290) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE SLC25A25. Peptide sequence: MSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A25
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC25A25 Antibody - BSA Free

• APC3
• calcium-binding mitochondrial carrier protein SCaMC-2
• KIAA1896RP11-395P17.4
• MCSC
• MCSC3
• MGC105138
• MGC119514
• MGC119515
• MGC119516
• MGC119517
• Mitochondrial ATP-Mg/Pi carrier protein 3
• Mitochondrial Ca(2+)-dependent solute carrier protein 3
• mitochondrial Ca2+-dependent solute carrier
• PCSCL
• SCAMC2
• SCAMC-2
• short calcium-binding mitochondrial carrier 2
• small calcium-binding mitochondrial carrier 2
• Small calcium-binding mitochondrial carrier protein 2
• solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
• Solute carrier family 25 member 25
• solute carrier family 25, member 25

Background

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites,nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediatesthe transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into orfrom the mitochondria

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A25