SLC25A25 Antibody

Images

 
Western Blot: SLC25A25 Antibody [NBP2-88290] - Host: Rabbit. Target Name: Slc25a25. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A25 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE SLC25A25. Peptide sequence: MSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A25 Antibody

  • APC3
  • calcium-binding mitochondrial carrier protein SCaMC-2
  • KIAA1896RP11-395P17.4
  • MCSC
  • MCSC3
  • MGC105138
  • MGC119514
  • MGC119515
  • MGC119516
  • MGC119517
  • Mitochondrial ATP-Mg/Pi carrier protein 3
  • Mitochondrial Ca(2+)-dependent solute carrier protein 3
  • mitochondrial Ca2+-dependent solute carrier
  • PCSCL
  • SCAMC2
  • SCAMC-2
  • short calcium-binding mitochondrial carrier 2
  • small calcium-binding mitochondrial carrier 2
  • Small calcium-binding mitochondrial carrier protein 2
  • solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
  • Solute carrier family 25 member 25
  • solute carrier family 25, member 25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-57669
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89095
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-20389
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61656
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01128
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4497
Species: Hu
Applications: Simple Western, WB
NBP1-89020
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-59828
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67818
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-40367
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-67820
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-88290
Species: Mu
Applications: WB

Publications for SLC25A25 Antibody (NBP2-88290) (0)

There are no publications for SLC25A25 Antibody (NBP2-88290).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A25 Antibody (NBP2-88290) (0)

There are no reviews for SLC25A25 Antibody (NBP2-88290). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A25 Antibody (NBP2-88290) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A25 Products

Bioinformatics Tool for SLC25A25 Antibody (NBP2-88290)

Discover related pathways, diseases and genes to SLC25A25 Antibody (NBP2-88290). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A25 Antibody (NBP2-88290)

Discover more about diseases related to SLC25A25 Antibody (NBP2-88290).
 

Pathways for SLC25A25 Antibody (NBP2-88290)

View related products by pathway.

Blogs on SLC25A25

There are no specific blogs for SLC25A25, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A25