Recombinant Human SLC25A15 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC25A15 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-301 of Human SLC25A15 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SLC25A15

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC25A15 Protein

  • D13S327
  • mitochondrial ornithine transporter 1
  • ORC1
  • ornithine transporter 1
  • ORNT1HHH
  • solute carrier family 25 (mitochondrial carrier; ornithine transporter) member15
  • Solute carrier family 25 member 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-06099
Species: Hu
NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB100-798
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00023594-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82476
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00010166-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SLC25A15 Recombinant Protein (H00010166-P01) (0)

There are no publications for SLC25A15 Recombinant Protein (H00010166-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A15 Recombinant Protein (H00010166-P01) (0)

There are no reviews for SLC25A15 Recombinant Protein (H00010166-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A15 Recombinant Protein (H00010166-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC25A15 Products

Bioinformatics Tool for SLC25A15 Recombinant Protein (H00010166-P01)

Discover related pathways, diseases and genes to SLC25A15 Recombinant Protein (H00010166-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A15 Recombinant Protein (H00010166-P01)

Discover more about diseases related to SLC25A15 Recombinant Protein (H00010166-P01).
 

Pathways for SLC25A15 Recombinant Protein (H00010166-P01)

View related products by pathway.

Blogs on SLC25A15

There are no specific blogs for SLC25A15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC25A15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A15