SLC24A4 Antibody (NBP1-59897)

Images

 
Western Blot: SLC24A4 Antibody [NBP1-59897] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC24A4 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC24A4(solute carrier family 24 (sodium/potassium/calcium exchanger), member 4) The peptide sequence was selected from the N terminal of SLC24A4. Peptide sequence PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC24A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC24A4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC24A4 Antibody

  • Na(+)/K(+)/Ca(2+)-exchange protein 4
  • NCKX4FLJ38852
  • SHEP6
  • SLC24A2
  • sodium/potassium/calcium exchanger 4
  • solute carrier family 24 (sodium/potassium/calcium exchanger), member 4
  • Solute carrier family 24 member 4

Background

Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions (Li et al., 2002 [PubMed 12379639]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31010
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92397
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-60052
Species: Hu
Applications: WB
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P
NBP1-59786
Species: Hu
Applications: WB
NBP1-83973
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48980
Species: Hu
Applications: IHC
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37922
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB3650
Species: Hu
Applications: Flow, CyTOF-ready
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NB120-2869
Species: Hu, Mu, Rt, Po, Bv, Ca, GP, I, Kg, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-40795
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP1-59897
Species: Hu
Applications: WB

Publications for SLC24A4 Antibody (NBP1-59897) (0)

There are no publications for SLC24A4 Antibody (NBP1-59897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC24A4 Antibody (NBP1-59897) (0)

There are no reviews for SLC24A4 Antibody (NBP1-59897). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC24A4 Antibody (NBP1-59897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC24A4 Products

SLC24A4 NBP1-59897

Related Products by Gene

Bioinformatics Tool for SLC24A4 Antibody (NBP1-59897)

Discover related pathways, diseases and genes to SLC24A4 Antibody (NBP1-59897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC24A4 Antibody (NBP1-59897)

Discover more about diseases related to SLC24A4 Antibody (NBP1-59897).
 

Pathways for SLC24A4 Antibody (NBP1-59897)

View related products by pathway.

PTMs for SLC24A4 Antibody (NBP1-59897)

Learn more about PTMs related to SLC24A4 Antibody (NBP1-59897).

Blogs on SLC24A4

There are no specific blogs for SLC24A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC24A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC24A4
Uniprot