SLC24A4 Antibody


Western Blot: SLC24A4 Antibody [NBP1-59897] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SLC24A4 Antibody Summary

Synthetic peptides corresponding to SLC24A4(solute carrier family 24 (sodium/potassium/calcium exchanger), member 4) The peptide sequence was selected from the N terminal of SLC24A4. Peptide sequence PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVF
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC24A4 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC24A4 Antibody

  • Na(+)/K(+)/Ca(2+)-exchange protein 4
  • NCKX4FLJ38852
  • SHEP6
  • SLC24A2
  • sodium/potassium/calcium exchanger 4
  • solute carrier family 24 (sodium/potassium/calcium exchanger), member 4
  • Solute carrier family 24 member 4


Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions (Li et al., 2002 [PubMed 12379639]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
Species: Hu, Mu, Rt, Po, Bv, Ca, GP, I, Kg, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Species: Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for SLC24A4 Antibody (NBP1-59897) (0)

There are no publications for SLC24A4 Antibody (NBP1-59897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC24A4 Antibody (NBP1-59897) (0)

There are no reviews for SLC24A4 Antibody (NBP1-59897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC24A4 Antibody (NBP1-59897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC24A4 Products

SLC24A4 NBP1-59897

Bioinformatics Tool for SLC24A4 Antibody (NBP1-59897)

Discover related pathways, diseases and genes to SLC24A4 Antibody (NBP1-59897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC24A4 Antibody (NBP1-59897)

Discover more about diseases related to SLC24A4 Antibody (NBP1-59897).

Pathways for SLC24A4 Antibody (NBP1-59897)

View related products by pathway.

PTMs for SLC24A4 Antibody (NBP1-59897)

Learn more about PTMs related to SLC24A4 Antibody (NBP1-59897).

Blogs on SLC24A4

There are no specific blogs for SLC24A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC24A4 Antibody and receive a gift card or discount.


Gene Symbol SLC24A4