SLC19A2 Antibody (5B10) - Azide and BSA Free

Western Blot: SLC19A2 Antibody (5B10) [H00010560-M10] - Analysis of SLC19A2 expression in A-431 (Cat # L015V1).

ELISA: SLC19A2 Antibody (5B10) [H00010560-M10] - Detection limit for recombinant GST tagged SLC19A2 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5B10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC19A2 Antibody (5B10) - Azide and BSA Free Summary

• Immunogen: SLC19A2 (NP_008927.1, 209 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND
• Specificity: SLC19A2 - solute carrier family 19 (thiamine transporter), member 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC19A2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC19A2 Antibody (5B10) - Azide and BSA Free

• high affinity thiamine transporter
• reduced folate carrier protein (RFC) like
• solute carrier family 19 (thiamine transporter), member 2
• Solute carrier family 19 member 2
• TC1
• Thiamine carrier 1
• thiamine transporter 1
• THT1
• ThTr1
• ThTr-1
• THTR1thTr-1
• TRMA

Background

This gene encodes the thiamin transporter protein. Mutations in this gene cause thiamin-responsive megaloblastic anemia syndrome (TRMA), which is an autosomal recessive disorder characterized by diabetes mellitus, megaloblastic anemia and sensorineural deafness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for SLC19A2 Antibody (H00010560-M10) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 09/24/2023

Summary

• Application: Western Blot
• Sample Tested: Human Glioma cells, whole cell lysates
• Species: Human
• Lot: GB231-5B10

Bioinformatics

• Gene Symbol: SLC19A2
• Entrez:
  • 10560(Human)
• OMIM:
  • 249270(Human)
• Uniprot:
  • NP_008927.1(Human)