SLC13A3/NaDC3 Antibody

Images

 
Western Blot: SLC13A3/NaDC3 Antibody [NBP1-69630] - This Anti-SLC13A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC13A3/NaDC3 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC13A3(solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3) The peptide sequence was selected from the N terminal of SLC13A3 (NP_073740). Peptide sequence MAVYWCTEALPLSVTALLPIVLFPFMGILPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC13A3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 5 ug/ml
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC13A3/NaDC3 Antibody

  • hNaDC3
  • Na(+)/dicarboxylate cotransporter 3
  • NaDC3
  • NaDC-3
  • NADC3SDCT2naDC-3
  • SDCT2
  • SLC13A3
  • sodium-dependent high affinity dicarboxylate transporter 3
  • Sodium-dependent high-affinity dicarboxylate transporter 2
  • solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
  • solute carrier family 13 member 3

Background

Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-62518
Species: Hu
Applications: WB, IHC, IHC-P
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92394
Species: Hu
Applications: IHC, IHC-P
NBP2-30984
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13313
Species: Hu
Applications: IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69536
Species: Hu
Applications: WB
NBP2-05754
Species: Hu
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00001836-M04
Species: Hu
Applications: WB, ELISA
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-47272
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88814
Species: Hu
Applications: IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow

Publications for SLC13A3/NaDC3 Antibody (NBP1-69630) (0)

There are no publications for SLC13A3/NaDC3 Antibody (NBP1-69630).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC13A3/NaDC3 Antibody (NBP1-69630) (0)

There are no reviews for SLC13A3/NaDC3 Antibody (NBP1-69630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC13A3/NaDC3 Antibody (NBP1-69630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC13A3/NaDC3 Products

Bioinformatics Tool for SLC13A3/NaDC3 Antibody (NBP1-69630)

Discover related pathways, diseases and genes to SLC13A3/NaDC3 Antibody (NBP1-69630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC13A3/NaDC3 Antibody (NBP1-69630)

Discover more about diseases related to SLC13A3/NaDC3 Antibody (NBP1-69630).
 

Pathways for SLC13A3/NaDC3 Antibody (NBP1-69630)

View related products by pathway.

PTMs for SLC13A3/NaDC3 Antibody (NBP1-69630)

Learn more about PTMs related to SLC13A3/NaDC3 Antibody (NBP1-69630).

Blogs on SLC13A3/NaDC3

There are no specific blogs for SLC13A3/NaDC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC13A3/NaDC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC13A3
Entrez
Uniprot