Reactivity | Hu, Mu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to SLC10A7(solute carrier family 10 (sodium/bile acid cotransporter family), member 7) The peptide sequence was selected from the middle region of SLC10A7.
Peptide sequence TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSF The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Mouse (100%), Rat (100%), Porcine (93%), Rabbit (100%), Bovine (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SLC10A7 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against SLC10A7 and was validated on Western blot. |
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-59875 | Applications | Species |
---|---|---|
Laugel-Haushalter V, Bar S, Schaefer E et al. A New SLC10A7 Homozygous Missense Mutation Responsible for a Milder Phenotype of Skeletal Dysplasia With Amelogenesis Imperfecta Front Genet May 28 2019 [PMID: 31191616] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for SLC10A7 Antibody (NBP1-59875)Discover more about diseases related to SLC10A7 Antibody (NBP1-59875).
| Pathways for SLC10A7 Antibody (NBP1-59875)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.