SLC10A7 Antibody


Western Blot: SLC10A7 Antibody [NBP1-59875] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB

Order Details

SLC10A7 Antibody Summary

Synthetic peptides corresponding to SLC10A7(solute carrier family 10 (sodium/bile acid cotransporter family), member 7) The peptide sequence was selected from the middle region of SLC10A7. Peptide sequence TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSF The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (93%), Rabbit (100%), Bovine (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC10A7 and was validated on Western blot.
Read Publication using
NBP1-59875 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC10A7 Antibody

  • C4orf13
  • chromosome 4 open reading frame 13
  • DKFZp313H0531
  • DKFZp566M114
  • DKFZp779O2438
  • MGC25043
  • Na(+)/bile acid cotransporter 7
  • P7
  • SBF-domain containing protein
  • sodium/bile acid cotransporter 7
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 7
  • Solute carrier family 10 member 7


SLC10A7 belongs to the sodium: bile acid symporter family. It is a multi-pass membrane protein. The function of SLC10A7 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC

Publications for SLC10A7 Antibody (NBP1-59875)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for SLC10A7 Antibody (NBP1-59875) (0)

There are no reviews for SLC10A7 Antibody (NBP1-59875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC10A7 Antibody (NBP1-59875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SLC10A7 Products

Bioinformatics Tool for SLC10A7 Antibody (NBP1-59875)

Discover related pathways, diseases and genes to SLC10A7 Antibody (NBP1-59875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC10A7 Antibody (NBP1-59875)

Discover more about diseases related to SLC10A7 Antibody (NBP1-59875).

Pathways for SLC10A7 Antibody (NBP1-59875)

View related products by pathway.

Blogs on SLC10A7

There are no specific blogs for SLC10A7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC10A7 Antibody and receive a gift card or discount.


Gene Symbol SLC10A7