SLC10A7 Antibody

Western Blot: SLC10A7 Antibody [NBP1-59875] - SLC10A7 expression in control and patient skin fibroblasts as detected by western blot. The stain-free membrane, displaying the total amount of protein loaded, was used for quantification. The western blot shown corresponds to one significant experiment (n = 3). The data plotted were the mean of three independent experiments. Statistical analysis was done with the t-test and the p was determined *p < 0.05. Image collected and cropped by CiteAb from the following publication (frontiersin.org/article/10.3389/fgene.2019.00504/full), licensed under a CC-BY licence.

Western Blot: SLC10A7 Antibody [NBP1-59875] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC10A7 Antibody Summary

• Immunogen: Synthetic peptides corresponding to SLC10A7(solute carrier family 10 (sodium/bile acid cotransporter family), member 7). The peptide sequence was selected from the middle region of SLC10A7. Peptide sequence: TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC10A7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against SLC10A7 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC10A7 Antibody

• C4orf13
• chromosome 4 open reading frame 13
• DKFZp313H0531
• DKFZp566M114
• DKFZp779O2438
• MGC25043
• Na(+)/bile acid cotransporter 7
• P7
• SBF-domain containing protein
• sodium/bile acid cotransporter 7
• solute carrier family 10 (sodium/bile acid cotransporter family), member 7
• Solute carrier family 10 member 7

Background

SLC10A7 belongs to the sodium: bile acid symporter family. It is a multi-pass membrane protein. The function of SLC10A7 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC10A7 Antibody (NBP1-59875)(1)

Publication using NBP1-59875

• Laugel-Haushalter V, Bar S, Schaefer E et al. A New SLC10A7 Homozygous Missense Mutation Responsible for a Milder Phenotype of Skeletal Dysplasia With Amelogenesis Imperfecta Front Genet 2019-05-28 [PMID: 31191616] (WB, Human)

Bioinformatics

• Gene Symbol: SLC10A7
• Uniprot:
  • Q0GE19-2(Human)