Novus Biologicals products are now on

SLC10A7 Antibody


Western Blot: SLC10A7 Antibody [NBP1-59875] - SLC10A7 expression in control and patient skin fibroblasts as detected by western blot. The stain-free membrane, displaying the total amount of protein loaded, was used for more
Western Blot: SLC10A7 Antibody [NBP1-59875] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
(B) SLC10A7 expression in control and patient skin fibroblasts as detected by western blot. The stain-free membrane, displaying the total amount of protein loaded, was used for quantification. The western blot shown more

Product Details

Reactivity HuSpecies Glossary
Applications WB
0.5 mg/ml

Order Details

SLC10A7 Antibody Summary

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Synthetic peptides corresponding to SLC10A7(solute carrier family 10 (sodium/bile acid cotransporter family), member 7). The peptide sequence was selected from the middle region of SLC10A7. Peptide sequence: TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Read Publication using
NBP1-59875 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for SLC10A7 Antibody

  • C4orf13
  • chromosome 4 open reading frame 13
  • DKFZp313H0531
  • DKFZp566M114
  • DKFZp779O2438
  • MGC25043
  • Na(+)/bile acid cotransporter 7
  • P7
  • SBF-domain containing protein
  • sodium/bile acid cotransporter 7
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 7
  • Solute carrier family 10 member 7


SLC10A7 belongs to the sodium: bile acid symporter family. It is a multi-pass membrane protein. The function of SLC10A7 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB

Publications for SLC10A7 Antibody (NBP1-59875)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for SLC10A7 Antibody (NBP1-59875) (0)

There are no reviews for SLC10A7 Antibody (NBP1-59875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC10A7 Antibody (NBP1-59875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC10A7 Antibody and receive a gift card or discount.


Gene Symbol SLC10A7