Skp2 Antibody (2L0K1)

Western Blot: Skp2 Antibody (2L0K1) [NBP3-16320] - Western blot analysis of extracts of HeLa cells, using Skp2 Rabbit mAb (NBP3-16320) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunohistochemistry-Paraffin: Skp2 Antibody (2L0K1) [NBP3-16320] - Immunohistochemistry of paraffin-embedded human colon using Skp2 Rabbit mAb (NBP3-16320) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Western Blot: Skp2 Antibody (2L0K1) [NBP3-16320] - Western blot analysis of extracts of various cell lines, using Skp2 Rabbit mAb (NBP3-16320) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 2L0K1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Skp2 Antibody (2L0K1) Summary

• Description: Novus Biologicals Rabbit Skp2 Antibody (2L0K1) (NBP3-16320) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Skp2 (Q13309). MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SKP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Skp2 Antibody (2L0K1)

• CDK2/cyclin A-associated protein p45
• cyclin A/CDK2-associated protein p45
• Cyclin-A/CDK2-associated protein p45
• FBL1
• F-box protein Skp2
• F-box/LRR-repeat protein 1
• FBXL1
• FBXL1MGC1366
• FLB1
• p45skp2
• Skp2
• S-phase kinase-associated protein 2 (p45)
• S-phase kinase-associated protein 2

Background

The critical role that the family of regulatory proteins known as cyclins plays in eukaryotic cell cycle regulation is well established. The best characterized cyclin complex is the mitotic cyclin B/Cdc2 p34 kinase, the active component of MPF (maturation promoting factor). Cyclin A accumulates prior to cyclin B in the cell cycle, appears to be involved in control of S phase and has been shown to associate with cyclin dependent kinase 2 (Cdk2). In addition, cyclin A has been implicated in cell transformation and is found in complexes with E1A, transcription factors DP-1 and E2F, and retinoblastoma protein p110. Two cyclin A-Cdk2 complex binding proteins, Skp1 p19 and Skp2 p45, have been described. Although the Skps (S phase kinase-associated proteins) associate with the active cyclin A-Cdk2 complex, they do not exhibit any regulatory effects on the complex. Abolition of Skp2 p45 function by either microinjection of anti-p45 antibodies or addition of antisense oligonucleotides prevents entry into S phase of both normal and transformed cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SKP2