Skp1 Antibody [Alexa Fluor® 594]

Product Discontinued

Skp1 Antibody [Alexa Fluor® 594] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human Skp1 (NP_733779.1).
  
  Sequence:
  MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SKP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Skp1 Antibody [Alexa Fluor® 594]

• Cyclin-A/CDK2-associated protein p19
• EMC19p19skp1
• MGC34403
• OCP2
• OCP2OCP-2
• OCP-IIS-phase kinase-associated protein 1A (p19A)
• Organ of Corti protein 2
• Organ of Corti protein II
• p19a
• p19Acyclin A/CDK2-associated p19
• p19Skp1
• RNA polymerase II elongation factor-like protein OCP2
• RNA polymerase II elongation factor-like protein
• SKP1
• SKP1A
• SKP1Acyclin A/CDK2-associated protein p19
• S-phase kinase-associated protein 1
• TCEB1LSIII
• Transcription elongation factor B

Background

Skp1 encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SKP1