SKIV2L Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SKIV2L Antibody [NBP3-17769] - Staining of human cell line HEK 293 shows localization to nucleoplasm & nuclear bodies.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SKIV2L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SKIV2L Antibody - BSA Free (NBP3-17769) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SKIV2L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SKIV2L Antibody - BSA Free

• 170A
• DDX13helicase SKI2W
• EC 3.6.1
• Helicase-like protein
• HLPEC 3.6.4.-
• SKI2
• SKI2Wsuperkiller viralicidic activity 2 (S. cerevisiae homolog)-like
• SKIV2
• superkiller viralicidic activity 2-like (S. cerevisiae)
• W

Background

SKIV2L - superkiller viralicidic activity 2-like (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SKIV2L