SIRP beta 1/CD172b Antibody - BSA Free

Western Blot: SIRP beta 1/CD172b Antibody [NBP2-83528] - Host: Rabbit. Target Name: SIRPB1. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SIRP beta 1/CD172b Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SIRP beta 1/CD172b. Peptide sequence: TCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIRPB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SIRP beta 1/CD172b Antibody - BSA Free

• CD172 antigen-like family member B
• CD172b antigen
• CD172b
• DKFZp686A05192
• FLJ26614
• signal-regulatory protein beta 1
• signal-regulatory protein beta-1
• SIRP beta 1
• SIRPB1
• SIRP-beta-1 isoform 3
• SIRP-BETA-1

Background

The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIRPB1