![Sandwich ELISA: SIN3B Antibody (2C11) [H00023309-M02] - Detection limit for recombinant GST tagged SIN3B is 3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SIN3B-Antibody-2C11-Sandwich-ELISA-H00023309-M02-img0001.jpg "Sandwich ELISA: SIN3B Antibody (2C11) [H00023309-M02] - Detection limit for recombinant GST tagged SIN3B is 3 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | ELISA |
| Clone | 2C11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | SIN3B (NP_056075.1, 1063 a.a. ~ 1160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPA |
| Specificity | SIN3B - SIN3 homolog B, transcription regulator (yeast) (2C11) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SIN3B |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
