SIN3B Antibody (2C11)

Images

 
Sandwich ELISA: SIN3B Antibody (2C11) [H00023309-M02] - Detection limit for recombinant GST tagged SIN3B is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
2C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SIN3B Antibody (2C11) Summary

Immunogen
SIN3B (NP_056075.1, 1063 a.a. ~ 1160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPA
Specificity
SIN3B - SIN3 homolog B, transcription regulator (yeast) (2C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SIN3B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SIN3B Antibody (2C11)

  • Histone deacetylase complex subunit Sin3b
  • KIAA0700paired amphipathic helix protein Sin3b
  • SIN3 homolog B, transcription regulator (yeast)
  • SIN3 homolog B, transcriptional regulator (yeast)
  • SIN3 homolog B, transcriptional regulator
  • Transcriptional corepressor Sin3b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
NBP1-89979
Species: Hu
Applications: IHC, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
NB600-1263
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P, ChIP
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Ma-Op, Pm
Applications: WB, IHC, IHC-P
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P, KD
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83109
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-21374
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-57636
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SIN3B Antibody (H00023309-M02) (0)

There are no publications for SIN3B Antibody (H00023309-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIN3B Antibody (H00023309-M02) (0)

There are no reviews for SIN3B Antibody (H00023309-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SIN3B Antibody (H00023309-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SIN3B Products

Bioinformatics Tool for SIN3B Antibody (H00023309-M02)

Discover related pathways, diseases and genes to SIN3B Antibody (H00023309-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIN3B Antibody (H00023309-M02)

Discover more about diseases related to SIN3B Antibody (H00023309-M02).
 

Pathways for SIN3B Antibody (H00023309-M02)

View related products by pathway.

PTMs for SIN3B Antibody (H00023309-M02)

Learn more about PTMs related to SIN3B Antibody (H00023309-M02).

Blogs on SIN3B

There are no specific blogs for SIN3B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIN3B Antibody (2C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol SIN3B
Entrez
Uniprot