Home » SIN3B » SIN3B Research Products » SIN3B Antibody (2C11)

SIN3B Antibody (2C11)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: SIN3B Antibody (2C11) [H00023309-M02] - Detection limit for recombinant GST tagged SIN3B is 3 ng/ml as a capture antibody.
Sandwich ELISA: SIN3B Antibody (2C11) [H00023309-M02] - Detection limit for recombinant GST tagged SIN3B is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
2C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SIN3B Antibody (2C11) Summary

Immunogen
SIN3B (NP_056075.1, 1063 a.a. ~ 1160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPA
Specificity
SIN3B - SIN3 homolog B, transcription regulator (yeast) (2C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SIN3B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SIN3B Antibody (2C11)

  • Histone deacetylase complex subunit Sin3b
  • KIAA0700paired amphipathic helix protein Sin3b
  • SIN3 homolog B, transcription regulator (yeast)
  • SIN3 homolog B, transcriptional regulator (yeast)
  • SIN3 homolog B, transcriptional regulator
  • Transcriptional corepressor Sin3b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HDAC1 Antibody
NB100-56340
Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: HDAC1 Antibody [NB100-56340] - Analysis of HDAC1 in HEK293 cell lysate with this antibody.
Immunohistochemistry-Paraffin: HDAC1 Antibody [NB100-56340] - Human testis using HDAC1 antibody at 1:250 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Staining was performed by Histowiz.
(2 Reviews)
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
Mad Antibody
NBP1-89979
Immunohistochemistry-Paraffin: Mad Antibody [NBP1-89979] - Staining in human bone marrow and liver tissues using anti-MXD1 antibody. Corresponding MXD1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Mad Antibody [NBP1-89979] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Mad Antibody [NBP1-89979] - Staining of human liver shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
MAD1L1/MAD1
Antibody
NBP1-32775
Western Blot: MAD1L1/MAD1 Antibody [NBP1-32775] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with MAD1 antibody diluted by 1:5000.
Immunocytochemistry/Immunofluorescence: MAD1L1/MAD1 Antibody [NBP1-32775] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: MAD1 protein stained by MAD1 antibody diluted at 1:500. Red: HEC1, a kinetochore marker, stained by HEC1 antibody [9G3.23] diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: MAD1L1/MAD1 Antibody [NBP1-32775] - Paraffin-embedded SW480 Xenograft, using antibody at 1:100 dilution.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NCOR1 Antibody
NB100-58824
Western Blot: NCOR1 Antibody [NB100-58824] - Whole cell lysate (50 ug) from HEK293T, K-562, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-NCoR antibodyused for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3minutes.
Chromatin Immunoprecipitation Sequencing: NCOR1 Antibody [NB100-58824] - Localization of NCoR Binding Sites by ChIP-sequencing. Chromatin from K562 cells was immunoprecipitated with anti-NCoR antibody NB100-58824 and analyzed by DNA sequencing. The figure illustrates the peak distribution of NCoR binding within a 650 Kb region of the human X chromosome as detected using anti-NCoR antibody NB100-58824. ChIP-seq validation performed by Diogenode, Denville, NJ.
Immunoprecipitation: NCOR1 Antibody [NB100-58824] - Detection of Human NCOR on HeLa whole cell lysate using NB100-5882. NCOR was also immunoprecipitated by rabbit anti-NCOR antibody NB100-58825.
(3 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
SIN3A Antibody
NB600-1263
Western Blot: SIN3A Antibody [NB600-1263] - Analysis of K562 cell extract.
Immunocytochemistry/Immunofluorescence: SIN3A Antibody [NB600-1263] - Analysis of Sin3A (green) showing staining in the nucleus of A431 cells (right) compared to a negative control without primary antibody (left).
Immunohistochemistry-Paraffin: SIN3A Antibody [NB600-1263] - Analysis showing staining in the nucleus of human ovary carcinoma (right) compared to a negative control without primary antibody (left).
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
Histone
Deacetylase 2/HDAC2 A ...
NBP2-67451
Western Blot: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Analysis of HDAC2 on different lysates using anti-HDAC2 antibody at 1/1,000 dilution. Positive control: Lane 1: 293T Lane 2: K562
Immunocytochemistry/Immunofluorescence: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Staining HDAC2 in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Analysis of paraffin-embedded rat spinal cord tissue using anti-HDAC2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
HDAC9 Antibody
NBP2-03993
Western Blot: HDAC9 Antibody [NBP2-03993] - Analysis of HDAC-9 in human HeLa cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) and mouse RAW cell lysate using this antibody. 0 ug/ml, 1.0 ug/ml and 0.5 ug/ml respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Review)
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NRSF Antibody
NB100-757
Western Blot: NRSF Antibody [NB100-757] - Detection of Human REST by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-REST antibody NB100-757 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: NRSF Antibody [NB100-757] - FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- REST used at a dilution of 1:1,000 (1ug/ml). Detection: DAB Counterstain: IHC Hematoxylin (blue).
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, ChIP
p130 Antibody
NBP1-82455
Western Blot: p130 Antibody [NBP1-82455] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: p130 Antibody [NBP1-82455] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human tonsil shows strong nuclear positivity in lymphoid cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AMPD1 Antibody
NBP2-24509
Western Blot: AMPD1 Antibody [NBP2-24509] - Analysis of human AMPDA1 in mouse skeletal muscle lysate in the 1) absence, 2) presence of immunizing peptide and 3) rat skeletal muscle using NBP2-24509 at 1 ug/ml.
Immunohistochemistry-Paraffin: AMPD1 Antibody [NBP2-24509] - Analysis of human skeletal muscle using NBP2-24509 at 10 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt, Bv, Ca, Ma-Op, Pm
Applications: WB, IHC, IHC-P
p107 Antibody
NBP2-33735
Western Blot: p107 Antibody [NBP2-33735] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: p107 Antibody [NBP2-33735] - Selinexor alters pocket protein expression in nuclear and cytoplasmic compartments. Representative images of p107, p130 and RB (green) IF staining of bladder cancer cells treated with vehicle (V) or selinexor (S) for 48 hours. Tubulin staining (red) and DAPI staining (blue) served to define the cytoplasmic and nuclear compartments, respectively. The inserts are magnifications of the boxed cells. Image collected and cropped by CiteAb from the following publication (http://www.oncotarget.com/fulltext/26179), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: p107 Antibody [NBP2-33735] - Staining of human colon, kidney, liver and testis using Anti-p107 antibody NBP2-33735 (A) shows similar protein distribution across tissues to independent antibody NBP2-33791 (B).
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NOLC1 Antibody
NBP1-58200
Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.
Immunocytochemistry/Immunofluorescence: NOLC1 Antibody [NBP1-58200] - Zebrafish kidney, 1:250 Image Submitted By: James Lister Virginia Commonwealth University
Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-58200] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
RAB3GAP1 Antibody
NBP2-38206
Western Blot: RAB3GAP1 Antibody [NBP2-38206] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunohistochemistry-Paraffin: RAB3GAP1 Antibody [NBP2-38206] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: WB, IHC, IHC-P, KD
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image using the Alexa Fluor 488 format of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(49 Publications)
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
FoxK1 Antibody
NBP1-83109
Western Blot: FoxK1 Antibody [NBP1-83109] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: FoxK1 Antibody [NBP1-83109] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FoxK1 Antibody [NBP1-83109] - Analysis in human cerebral cortex and liver tissues using NBP1-83109 antibody. Corresponding FOXK1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Phenylalanine
Hydroxylase Antibody
NBP1-52084
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - (0.1ug/ml) staining of Mouse (A) and Rat (B) Liver lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Staining of paraffin embedded Human Kidney. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Analysis of Phenylalanine Hydroxylase Human Liver lysate (35ug protein in RIPA buffer) using this antibody at 0.3 ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
E2F-4 Antibody
NBP1-21374
Western Blot: E2F-4 Antibody [NBP1-21374] - Detection of Human E2F4 by Western Blot. Samples: Whole cell lysate from HeLa (5, 15, 50 ug) and 293T (50ug) cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-E2F4 antibody NBP1-21374 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: E2F-4 Antibody [NBP1-21374] - Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-E2F4 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: E2F-4 Antibody [NBP1-21374] - Detection of human E2F4 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-E2F4 antibody NBP1-21374 used for IP at 6 ug per reaction. E2F4 was also immunoprecipitated by another rabbit anti-E2F4 antibody. For blotting immunoprecipitated E2F4, NBP1-21374 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, IP
CBFA2T3 Antibody
NBP2-57636
Western Blot: CBFA2T3 Antibody [NBP2-57636] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: CBFA2T3 Antibody [NBP2-57636] - Staining of human tonsil shows strong nuclear positivity in germinal and non-germinal center cells.
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SIN3B Antibody (H00023309-M02) (0)

There are no publications for SIN3B Antibody (H00023309-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIN3B Antibody (H00023309-M02) (0)

There are no reviews for SIN3B Antibody (H00023309-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SIN3B Antibody (H00023309-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SIN3B Products

Bioinformatics Tool for SIN3B Antibody (H00023309-M02)

Discover related pathways, diseases and genes to SIN3B Antibody (H00023309-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIN3B Antibody (H00023309-M02)

Discover more about diseases related to SIN3B Antibody (H00023309-M02).
 

Pathways for SIN3B Antibody (H00023309-M02)

View related products by pathway.

PTMs for SIN3B Antibody (H00023309-M02)

Learn more about PTMs related to SIN3B Antibody (H00023309-M02).

Blogs on SIN3B

There are no specific blogs for SIN3B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIN3B Antibody (2C11) and receive a gift card or discount.


Bioinformatics

Gene Symbol SIN3B
Entrez
Uniprot