Recombinant Human SIL1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related SIL1 Peptides and Proteins

Order Details


    • Catalog Number
      H00064374-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SIL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 201-309 of Human SIL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EKIAALFDLEYYVHQMDNAQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATEQPLTAKKKVLFALCSLLRHFPYAQRQFLK

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SIL1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SIL1 Protein

  • BAPMarinesco-Sjogren syndrome
  • BiP-associated protein
  • MSS
  • nucleotide exchange factor SIL1
  • SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae)
  • ULG5

Background

SIL1 - endoplasmic reticulum chaperone SIL1, homolog of yeast

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-56552
Species: Hu
Applications: WB
NBP2-35213
Species: Hu
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
H00064374-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SIL1 Partial Recombinant Protein (H00064374-Q01) (0)

There are no publications for SIL1 Partial Recombinant Protein (H00064374-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIL1 Partial Recombinant Protein (H00064374-Q01) (0)

There are no reviews for SIL1 Partial Recombinant Protein (H00064374-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIL1 Partial Recombinant Protein (H00064374-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIL1 Products

Bioinformatics Tool for SIL1 Partial Recombinant Protein (H00064374-Q01)

Discover related pathways, diseases and genes to SIL1 Partial Recombinant Protein (H00064374-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIL1 Partial Recombinant Protein (H00064374-Q01)

Discover more about diseases related to SIL1 Partial Recombinant Protein (H00064374-Q01).
 

Pathways for SIL1 Partial Recombinant Protein (H00064374-Q01)

View related products by pathway.

PTMs for SIL1 Partial Recombinant Protein (H00064374-Q01)

Learn more about PTMs related to SIL1 Partial Recombinant Protein (H00064374-Q01).

Blogs on SIL1

There are no specific blogs for SIL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SIL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIL1