SIGLECL12 Antibody


Western Blot: SIGLECL1 Antibody [NBP1-59241] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SIGLECL12 Antibody Summary

Synthetic peptides corresponding to SIGLEC12(sialic acid binding Ig-like lectin 12) The peptide sequence was selected from the N terminal of SIGLEC12. Peptide sequence DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SIGLEC12 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SIGLECL12 Antibody

  • FLJ38600
  • S2V
  • sialic acid binding Ig-like lectin 12
  • sialic acid-binding Ig-like lectin 12
  • Siglec-12
  • SIGLECL1Sialic acid-binding Ig-like lectin-like 1
  • SIGLEC-like 1
  • Siglec-XII
  • SLG
  • SLGSiglec-L1


Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member of the SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor.Western blots using four different antibodies against four unique regions of this protein target confirm the same apparent molecular weight in our tests.Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, Flow
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
Species: Hu
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for SIGLECL12 Antibody (NBP1-59241) (0)

There are no publications for SIGLECL12 Antibody (NBP1-59241).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIGLECL12 Antibody (NBP1-59241) (0)

There are no reviews for SIGLECL12 Antibody (NBP1-59241). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIGLECL12 Antibody (NBP1-59241) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SIGLECL12 Products

Bioinformatics Tool for SIGLECL12 Antibody (NBP1-59241)

Discover related pathways, diseases and genes to SIGLECL12 Antibody (NBP1-59241). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIGLECL12 Antibody (NBP1-59241)

Discover more about diseases related to SIGLECL12 Antibody (NBP1-59241).

Pathways for SIGLECL12 Antibody (NBP1-59241)

View related products by pathway.

Blogs on SIGLECL12

There are no specific blogs for SIGLECL12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SIGLECL12 Antibody and receive a gift card or discount.


Gene Symbol SIGLEC12