SIAH3 Antibody

Images

 
Western Blot: SIAH3 Antibody [NBP2-83527] - Host: Rabbit. Target Name: SIAH3. Sample Type: Fetal Brain lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIAH3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SIAH3. Peptide sequence: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SIAH3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SIAH3 Antibody

  • Seven In Absentia Homolog 3 (Drosophila)
  • Seven In Absentia Homolog 3
  • Siah E3 Ubiquitin Protein Ligase Family Member 3
  • siah-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-06267
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4737
Species: Hu
Applications: WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-49142
Species: Hu
Applications: IHC, IHC-P, KD, WB
DY262
Species: Hu
Applications: ELISA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP2-56182
Species: Hu
Applications: ICC/IF
NB100-41371
Species: Ma, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-60414
Species: Hu
Applications: IP, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-83527
Species: Hu
Applications: WB

Publications for SIAH3 Antibody (NBP2-83527) (0)

There are no publications for SIAH3 Antibody (NBP2-83527).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIAH3 Antibody (NBP2-83527) (0)

There are no reviews for SIAH3 Antibody (NBP2-83527). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIAH3 Antibody (NBP2-83527) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIAH3 Products

Array NBP2-83527

Bioinformatics Tool for SIAH3 Antibody (NBP2-83527)

Discover related pathways, diseases and genes to SIAH3 Antibody (NBP2-83527). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIAH3 Antibody (NBP2-83527)

Discover more about diseases related to SIAH3 Antibody (NBP2-83527).

Blogs on SIAH3

There are no specific blogs for SIAH3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIAH3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIAH3