SI Sucrase-Isomaltase Antibody (1A8)

Images

 
Sandwich ELISA: SI Sucrase-Isomaltase Antibody (1A8) [H00006476-M01] - Detection limit for recombinant GST tagged SI is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SI Sucrase-Isomaltase Antibody (1A8) Summary

Immunogen
SI (NP_001032 1728 a.a. - 1826 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGESIDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPVNAVTLTYNGNKNSLPFNEDTTNMILRIDLTTHNVTLEEPIEINW
Specificity
SI (1A8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SI
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SI Sucrase-Isomaltase Antibody (1A8)

  • EC 3.2.1.20
  • MGC131621
  • MGC131622
  • oligosaccharide alpha-1,6-glucosidase
  • sucrase-isomaltase (alpha-glucosidase)
  • sucrase-isomaltase
  • sucrase-isomaltase, intestinal

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for SI Sucrase-Isomaltase Antibody (H00006476-M01) (0)

There are no publications for SI Sucrase-Isomaltase Antibody (H00006476-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SI Sucrase-Isomaltase Antibody (H00006476-M01) (0)

There are no reviews for SI Sucrase-Isomaltase Antibody (H00006476-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SI Sucrase-Isomaltase Antibody (H00006476-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SI Sucrase-Isomaltase Products

Bioinformatics Tool for SI Sucrase-Isomaltase Antibody (H00006476-M01)

Discover related pathways, diseases and genes to SI Sucrase-Isomaltase Antibody (H00006476-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SI Sucrase-Isomaltase Antibody (H00006476-M01)

Discover more about diseases related to SI Sucrase-Isomaltase Antibody (H00006476-M01).
 

Pathways for SI Sucrase-Isomaltase Antibody (H00006476-M01)

View related products by pathway.

PTMs for SI Sucrase-Isomaltase Antibody (H00006476-M01)

Learn more about PTMs related to SI Sucrase-Isomaltase Antibody (H00006476-M01).

Blogs on SI Sucrase-Isomaltase

There are no specific blogs for SI Sucrase-Isomaltase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SI Sucrase-Isomaltase Antibody (1A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SI
Entrez
OMIM
Uniprot