SHKBP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SHKBP1 Antibody [NBP1-87252] - Immunofluorescent staining of human cell line A-431 shows localization to cell junctions.
Immunohistochemistry-Paraffin: SHKBP1 Antibody [NBP1-87252] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHKBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PVFPVKRRNRHSLVGPQQLGGRPAPVRRSNTMPPNLGNAGLLGRMLDEKTPPSPSGQPEEPGMVRLVCGHHNWIAVAYTQFLVCYRLKEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHKBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SHKBP1 Protein (NBP1-87252PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHKBP1 Antibody

  • PP203
  • Sb1
  • SH3KBP1 binding protein 1
  • SH3KBP1-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80981
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-54692
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-30081
Species: Hu, Mu
Applications: WB, IP

Publications for SHKBP1 Antibody (NBP1-87252) (0)

There are no publications for SHKBP1 Antibody (NBP1-87252).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHKBP1 Antibody (NBP1-87252) (0)

There are no reviews for SHKBP1 Antibody (NBP1-87252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SHKBP1 Antibody (NBP1-87252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHKBP1 Products

Bioinformatics Tool for SHKBP1 Antibody (NBP1-87252)

Discover related pathways, diseases and genes to SHKBP1 Antibody (NBP1-87252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHKBP1 Antibody (NBP1-87252)

Discover more about diseases related to SHKBP1 Antibody (NBP1-87252).
 

Pathways for SHKBP1 Antibody (NBP1-87252)

View related products by pathway.

Blogs on SHKBP1

There are no specific blogs for SHKBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHKBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHKBP1