SHARPIN Antibody - BSA Free

Western Blot: SHARPIN Antibody [NBP1-92386] - Analysis in human cell lines PC-3 and Caco-2 using anti-SHARPIN antibody. Corresponding SHARPIN RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunohistochemistry-Paraffin: SHARPIN Antibody [NBP1-92386] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Western Blot: SHARPIN Antibody [NBP1-92386] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SHARPIN Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHARPIN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  SHARPIN Protein (NBP1-92386PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SHARPIN Antibody - BSA Free

• DKFZp434N1923
• hSIPL1
• SHANK-associated RH domain interactor
• Shank-associated RH domain-interacting protein
• Shank-interacting protein-like 1
• SHARPIN
• SIPL1
• SIPL1DKFZP434N1923

Background

SHARPIN may have a role in normal immune development and control of inflammation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHARPIN
• Entrez:
  • 81858(Human)
• Uniprot:
  • Q9H0F6()