SH3YL1 Antibody

Western Blot: SH3YL1 Antibody [NBP1-84133] - Analysis in human cell line SK-BR-3.

Immunohistochemistry-Paraffin: SH3YL1 Antibody [NBP1-84133] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SH3YL1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SH3YL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  SH3YL1 Protein (NBP1-84133PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SH3YL1 Antibody

• DKFZP586F1318
• FLJ39121
• Ray
• SH3 domain containing, Ysc84-like 1 (S. cerevisiae)
• SH3 domain-containing YSC84-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SH3YL1 Antibody (NBP1-84133)(2)

Publications using NBP1-84133

• Sun X, Liu Y, Zhou S et al. Circular Dorsal Ruffles Disturb the Growth Factor-induced PI3K-AKT Pathway in Hepatocellular Carcinoma Hep3B cells Research Square 2022-03-30 [PMID: 35799301] (ICC/IF, Human)
• Choi G, Min H, Cha J et al. SH3YL1 Protein as a Novel Biomarker for Diabetic Nephropathy in Type 2 Diabetes Mellitus Nutr Metab Cardiovasc Dis 2020-11-23 [PMID: 33223406]

Bioinformatics

• Gene Symbol: SH3YL1
• Entrez:
  • 26751(Human)
• Uniprot:
  • Q96HL8(Human)