SH3YL1 Antibody

Images

 
Western Blot: SH3YL1 Antibody [NBP1-84133] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-527
Immunohistochemistry-Paraffin: SH3YL1 Antibody [NBP1-84133] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3YL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3YL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
SH3YL1 Protein (NBP1-84133PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3YL1 Antibody

  • DKFZP586F1318
  • FLJ39121
  • Ray
  • SH3 domain containing, Ysc84-like 1 (S. cerevisiae)
  • SH3 domain-containing YSC84-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33519
Species: Hu
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-30785
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
AF3795
Species: Hu
Applications: WB, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49444
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84133
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SH3YL1 Antibody (NBP1-84133) (0)

There are no publications for SH3YL1 Antibody (NBP1-84133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3YL1 Antibody (NBP1-84133) (0)

There are no reviews for SH3YL1 Antibody (NBP1-84133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3YL1 Antibody (NBP1-84133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3YL1 Products

Bioinformatics Tool for SH3YL1 Antibody (NBP1-84133)

Discover related pathways, diseases and genes to SH3YL1 Antibody (NBP1-84133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3YL1 Antibody (NBP1-84133)

Discover more about diseases related to SH3YL1 Antibody (NBP1-84133).
 

Pathways for SH3YL1 Antibody (NBP1-84133)

View related products by pathway.

Blogs on SH3YL1

There are no specific blogs for SH3YL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3YL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3YL1
Entrez
Uniprot