SH3PXD2B Antibody - BSA Free

Western Blot: SH3PXD2B Antibody [NBP1-93965] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: SH3PXD2B Antibody [NBP1-93965] - Staining of human cell line U-2 OS shows localization to nucleus & plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SH3PXD2B Antibody [NBP1-93965] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Staining of human skeletal muscle shows low expression in myocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SH3PXD2B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SH3PXD2B Antibody - BSA Free (NBP1-93965) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SH3PXD2B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDATPQNPFLKSRPQV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SH3PXD2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SH3PXD2B Protein (NBP1-93965PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SH3PXD2B Antibody - BSA Free

• SH3 and PX domains 2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SH3PXD2B Antibody (NBP1-93965)(1)

Publication using NBP1-93965

• Wilson GR, Sunley J, Smith KR et al. Mutations in SH3PXD2B cause Borrone dermato-cardio-skeletal syndrome. Eur J Hum Genet 2014-06-01 [PMID: 24105366] (WB, Human)

Bioinformatics

• Gene Symbol: SH3PXD2B