SH3MD4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SH3MD4 Antibody [NBP2-31028] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry: SH3MD4 Antibody [NBP2-31028] - Staining of human stomach, lower shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3MD4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PRNNVVGGSPLAKGITTTMHPGSGSLSSLATATRPALPITTPQAHAQHPTASPPTGSCLRHSAQPTASQARSTISTAAHSAAQAQDRPTATVSPLRTQNSPSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3RF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SH3MD4 Protein (NBP2-31028PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3MD4 Antibody

  • EC 6.3.2
  • Plenty Of SH3s 2
  • Plenty Of SH3s-2
  • POSH2
  • SH3 Domain Containing Ring Finger 3
  • SH3 Domain-Containing RING Finger Protein 3
  • SH3 Multiple Domains 4
  • SH3 Multiple Domains Protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00057630-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP1-47542
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-76284
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-37573
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF875
Species: Hu
Applications: WB, IHC
NBP1-81125
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00011026-M01
Species: Hu
Applications: WB, ELISA

Publications for SH3MD4 Antibody (NBP2-31028) (0)

There are no publications for SH3MD4 Antibody (NBP2-31028).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3MD4 Antibody (NBP2-31028) (0)

There are no reviews for SH3MD4 Antibody (NBP2-31028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SH3MD4 Antibody (NBP2-31028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3MD4 Products

Bioinformatics Tool for SH3MD4 Antibody (NBP2-31028)

Discover related pathways, diseases and genes to SH3MD4 Antibody (NBP2-31028). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SH3MD4

There are no specific blogs for SH3MD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3MD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3RF3
Uniprot