SH3MD2 Antibody (3H3)

Images

 
Western Blot: SH3MD2 Antibody (3H3) [H00057630-M01] - SH3MD2 monoclonal antibody (M01), clone 3H3 Analysis of SH3MD2 expression in HeLa.
Western Blot: SH3MD2 Antibody (3H3) [H00057630-M01] - SH3MD2 monoclonal antibody (M01), clone 3H3. Analysis of SH3MD2 expression in PC-12.
ELISA: SH3MD2 Antibody (3H3) [H00057630-M01] - Detection limit for recombinant GST tagged SH3MD2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IP
Clone
3H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SH3MD2 Antibody (3H3) Summary

Immunogen
SH3MD2 (NP_065921, 790 a.a. ~ 888 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Specificity
SH3MD2 - SH3 multiple domains 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SH3RF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunoprecipitation
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using H00057630-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SH3MD2 Antibody (3H3)

  • EC 6.3.2
  • EC 6.3.2.-
  • KIAA1494SH3 multiple domains protein 2
  • Plenty of SH3s
  • POSHFLJ21602
  • Protein POSH
  • putative E3 ubiquitin-protein ligase SH3RF1
  • RING finger protein 142
  • RNF142plenty of SH3 domains
  • SH3 domain containing ring finger 1
  • SH3 domain-containing RING finger protein 1
  • SH3 multiple domains 2
  • SH3MD2

Background

This gene encodes a protein containing an N-terminus RING-finger, four SH3 domains, and a region implicated in binding of the Rho GTPase Rac. Via the RING-finger, the encoded protein has been shown to function as an ubiquitin-protein ligase involved in protein sorting at the trans-Golgi network. The encoded protein may also act as a scaffold for the c-Jun N-terminal kinase signaling pathway, facilitating the formation of a functional signaling module.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47839
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4559
Species: Hu
Applications: WB
H00009175-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-90201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC, KO

Publications for SH3MD2 Antibody (H00057630-M01)(3)

Reviews for SH3MD2 Antibody (H00057630-M01) (0)

There are no reviews for SH3MD2 Antibody (H00057630-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3MD2 Antibody (H00057630-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SH3MD2 Products

Bioinformatics Tool for SH3MD2 Antibody (H00057630-M01)

Discover related pathways, diseases and genes to SH3MD2 Antibody (H00057630-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3MD2 Antibody (H00057630-M01)

Discover more about diseases related to SH3MD2 Antibody (H00057630-M01).
 

Pathways for SH3MD2 Antibody (H00057630-M01)

View related products by pathway.

PTMs for SH3MD2 Antibody (H00057630-M01)

Learn more about PTMs related to SH3MD2 Antibody (H00057630-M01).
 

Research Areas for SH3MD2 Antibody (H00057630-M01)

Find related products by research area.

Blogs on SH3MD2

There are no specific blogs for SH3MD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3MD2 Antibody (3H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3RF1
Entrez
Uniprot