SH3MD2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SH3MD2 Antibody [NBP2-68988] - Staining of human cell line U-2 OS shows localization to intermediate filaments & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SH3MD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SH3MD2 Antibody - BSA Free (NBP2-68988) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLH
• Predicted Species: Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SH3RF1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for SH3MD2 Antibody - BSA Free

• EC 6.3.2
• EC 6.3.2.-
• KIAA1494SH3 multiple domains protein 2
• Plenty of SH3s
• POSHFLJ21602
• Protein POSH
• putative E3 ubiquitin-protein ligase SH3RF1
• RING finger protein 142
• RNF142plenty of SH3 domains
• SH3 domain containing ring finger 1
• SH3 domain-containing RING finger protein 1
• SH3 multiple domains 2
• SH3MD2

Background

SH3MD2 encodes a protein containing an N-terminus RING-finger, four SH3 domains, and a region implicated in binding of the Rho GTPase Rac. Via the RING-finger, the encoded protein has been shown to function as an ubiquitin-protein ligase involved in protein sorting at the trans-Golgi network. The encoded protein may also act as a scaffold for the c-Jun N-terminal kinase signaling pathway, facilitating the formation of a functional signaling module.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SH3RF1