Recombinant Human SH3BP4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SH3BP4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human SH3BP4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
SH3BP4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SH3BP4 Protein

  • BOG25SH3 domain-binding protein 4
  • EHB10
  • EH-binding protein 10
  • SH3-domain binding protein 4
  • transferrin receptor trafficking protein
  • Transferrin receptor-trafficking protein
  • TTP

Background

SH3BP4 - SH3-domain binding protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4245
Species: Hu
Applications: WB, IP
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF4779
Species: Hu
Applications: WB, IHC
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC

Publications for SH3BP4 Partial Recombinant Protein (H00023677-Q01) (0)

There are no publications for SH3BP4 Partial Recombinant Protein (H00023677-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3BP4 Partial Recombinant Protein (H00023677-Q01) (0)

There are no reviews for SH3BP4 Partial Recombinant Protein (H00023677-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3BP4 Partial Recombinant Protein (H00023677-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH3BP4 Products

Bioinformatics Tool for SH3BP4 Partial Recombinant Protein (H00023677-Q01)

Discover related pathways, diseases and genes to SH3BP4 Partial Recombinant Protein (H00023677-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3BP4 Partial Recombinant Protein (H00023677-Q01)

Discover more about diseases related to SH3BP4 Partial Recombinant Protein (H00023677-Q01).
 

Pathways for SH3BP4 Partial Recombinant Protein (H00023677-Q01)

View related products by pathway.

PTMs for SH3BP4 Partial Recombinant Protein (H00023677-Q01)

Learn more about PTMs related to SH3BP4 Partial Recombinant Protein (H00023677-Q01).
 

Research Areas for SH3BP4 Partial Recombinant Protein (H00023677-Q01)

Find related products by research area.

Blogs on SH3BP4

There are no specific blogs for SH3BP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SH3BP4 Antibody
NBP1-86274
ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SH3BP4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3BP4