SH2D1B Antibody (2B4) - Azide and BSA Free Summary
| Immunogen |
SH2D1B (NP_444512.2, 54 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP |
| Specificity |
Reacts with SH2 domain containing 1B. |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SH2D1B |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoprecipitation
- Sandwich ELISA
|
| Application Notes |
This antibody is reactive against recombinant protein in ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SH2D1B Antibody (2B4) - Azide and BSA Free
Background
By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for SH2D1B Antibody (H00117157-M04) (0)
There are no publications for SH2D1B Antibody (H00117157-M04).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SH2D1B Antibody (H00117157-M04) (0)
There are no reviews for SH2D1B Antibody (H00117157-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SH2D1B Antibody (H00117157-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SH2D1B Products
Research Areas for SH2D1B Antibody (H00117157-M04)
Find related products by research area.
|
Blogs on SH2D1B