We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SH2B2 Recombinant Protein Antigen

Images

 
There are currently no images for SH2B2 Protein (NBP2-13305PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SH2B2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH2B2.

Source: E. coli

Amino Acid Sequence: RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SH2B2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13305.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SH2B2 Recombinant Protein Antigen

  • adaptor protein with pleckstrin homology and src homology 2 domains
  • APSAdapter protein with pleckstrin homology and Src homology 2 domains
  • SH2 and PH domain-containing adapter protein APS
  • SH2B adapter protein 2
  • SH2B adaptor protein 2

Background

APS (adapter protein with Pleckstrin homology and Src homology 2 domains) is a member of the Lnk family, an adapter protein that is involved in B cell signaling, insulin signaling and cytoskeletal reorganization. A PH and an SH2 domain containing adapter protein that links activated tyrosine kinases to signaling pathways. It is tyrosine phosphorylated by JAK2, KIT and other kinases during B cell receptor stimulation of many different cytokines, chemokines and leukokines. APS has been shown to inhibit the JAK STAT pathway in collaboration with cCbl.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-1063
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-29373
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
NBP2-00641
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
AF6915
Species: Hu, Mu, Rt
Applications: WB
NBP1-80917
Species: Hu
Applications: IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA

Publications for SH2B2 Protein (NBP2-13305PEP) (0)

There are no publications for SH2B2 Protein (NBP2-13305PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH2B2 Protein (NBP2-13305PEP) (0)

There are no reviews for SH2B2 Protein (NBP2-13305PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SH2B2 Protein (NBP2-13305PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH2B2 Products

Array NBP2-13305PEP

Blogs on SH2B2

There are no specific blogs for SH2B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SH2B2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SH2B2