SGSM2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SGSM2 Antibody [NBP1-93637] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SGSM2 Antibody [NBP1-93637] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal and glia cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SGSM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGIQSSLDEGQSVGFEEEDGGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEAGEELAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWY
Specificity
Specificity of human SGSM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGSM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in reported in scientific literature (PMID: 30744493).
Control Peptide
SGSM2 Protein (NBP1-93637PEP)
Publications
Read Publication using
NBP1-93637 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SGSM2 Antibody

  • KIAA0397
  • RUN and TBC1 domain containing 1
  • RUN and TBC1 domain-containing protein 1
  • RUTBC1
  • small G protein signaling modulator 2 protein
  • small G protein signaling modulator 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-621
Species: Hu, Rt, Bv, Ca, Ha, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP
NBP1-85968
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NBP2-67820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-87002
Species: Hu
Applications: WB
NBP2-56429
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20041
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB7936
Species: Hu
Applications: IHC, CyTOF-ready, ICFlow
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83606
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP, KD
NBP1-93637
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SGSM2 Antibody (NBP1-93637)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SGSM2 Antibody (NBP1-93637) (0)

There are no reviews for SGSM2 Antibody (NBP1-93637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SGSM2 Antibody (NBP1-93637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SGSM2 Products

Bioinformatics Tool for SGSM2 Antibody (NBP1-93637)

Discover related pathways, diseases and genes to SGSM2 Antibody (NBP1-93637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGSM2 Antibody (NBP1-93637)

Discover more about diseases related to SGSM2 Antibody (NBP1-93637).
 

Pathways for SGSM2 Antibody (NBP1-93637)

View related products by pathway.

Blogs on SGSM2

There are no specific blogs for SGSM2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGSM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGSM2