SGLT1/SLC5A1 Antibody [DyLight 650]

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

SGLT1/SLC5A1 Antibody [DyLight 650] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human SGLT1/SLC5A1 (NP_000334.1).
  
  Sequence:
  ECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC5A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for SGLT1/SLC5A1 Antibody [DyLight 650]

• D22S675
• High affinity sodium-glucose cotransporter
• Na+/glucose cotransporter 1
• NAGT
• NAGTsodium/glucose cotransporter 1
• SGLT1
• SGLT1Na(+)/glucose cotransporter 1
• SLC5A1
• solute carrier family 5 (sodium/glucose cotransporter), member 1
• Solute carrier family 5 member 1

Background

Glucose transporters are integral membrane proteins that mediate the transport of glucose and structurally related substances across cellular membranes. Two families of glucose transporter have been identified: the facilitated diffusion glucose transporter family (GLUT family), also known as 'uniporters,' and the sodium dependent glucose transporter family (SGLT family), also known as 'cotransporters' or 'symporters'. The SGLT1 gene encodes a protein that is involved in the active transport of glucose and galactose into eukaryotic and some prokaryotic cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC5A1