SGK3 Antibody - BSA Free

Western Blot: SGK3 Antibody [NBP3-38447] - Western blot analysis of various lysates using SGK3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 10s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SGK3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SGK3 Antibody - BSA Free (NBP3-38447) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SGK3 (NP_037389.4).
  
  Sequence:
  MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SGK3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SGK3 Antibody - BSA Free

• CISK
• DKFZp781N0293
• EC 2.7.11
• EC 2.7.11.1
• serine/threonine-protein kinase Sgk3
• serum/glucocorticoid regulated kinase 3
• serum/glucocorticoid regulated kinase family, member 3
• serum/glucocorticoid regulated kinase-like
• Serum/glucocorticoid-regulated kinase 3
• Serum/glucocorticoid-regulated kinase-like
• SGK2
• SGK3
• SGKLcytokine-independent survival kinase

Background

SGKL/SGK3, also known as CISK for cytokine-independent survival kinase, is a SGK type protein kinase. The protein contains a lipid-binding phox homology (PX) domain, which is required for targeting SGKL/SGK3 protein to the endosomal compartment. SGKL/SGK3 functions downstream of the phosphoinositide 3-kinase (PI3K) cascade and has been implicated in cell survival. The protein has been shown to be phosphorylated and activated by 3-phosphoinositide-dependent protein kinase 1 (PDK1), and to a lesser extent insulin-like growth factor-1, in vitro. Activated SGKL/SGK3 has been shown to phosphorylate glycogen synthase kinase 3 beta (GSK-3beta) in vitro. SGKL/SGK3 expression has been documented in many human tissues but was found to be most abundant in lung. ESTs have been isolated from human tissue libraries, including normal liver, breast and thyroid and cancerous spleen, ear and pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SGK3