SG2NA Antibody

Images

 
Independent Antibodies: Western Blot: SG2NA Antibody [NBP1-80764] - Analysis using Anti-STRN3 antibody NBP1-80764 (A) shows similar pattern to independent antibody NBP1-80763 (B).
Immunocytochemistry/ Immunofluorescence: SG2NA Antibody [NBP1-80764] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: SG2NA Antibody [NBP1-80764] - Staining of human colon shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

SG2NA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWAEPITFPSGGGKS
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STRN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SG2NA Protein (NBP1-80764PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SG2NA Antibody

  • Cell cycle autoantigen SG2NA
  • cell cycle S/G2 nuclear autoantigen
  • GS2NA
  • S/G2 antigen
  • SG2NAnuclear autoantigen
  • striatin, calmodulin binding protein 3
  • striatin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-74571
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB3468
Species: Hu
Applications: ICC, WB
NBP3-03372
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
NBP1-92435
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001059-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-61873
Species: Hu
Applications: ELISA, Flow, WB
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-37485
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-33548
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
H00008636-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-80764
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SG2NA Antibody (NBP1-80764) (0)

There are no publications for SG2NA Antibody (NBP1-80764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SG2NA Antibody (NBP1-80764) (0)

There are no reviews for SG2NA Antibody (NBP1-80764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SG2NA Antibody (NBP1-80764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SG2NA Products

Bioinformatics Tool for SG2NA Antibody (NBP1-80764)

Discover related pathways, diseases and genes to SG2NA Antibody (NBP1-80764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SG2NA Antibody (NBP1-80764)

Discover more about diseases related to SG2NA Antibody (NBP1-80764).
 

Pathways for SG2NA Antibody (NBP1-80764)

View related products by pathway.

PTMs for SG2NA Antibody (NBP1-80764)

Learn more about PTMs related to SG2NA Antibody (NBP1-80764).

Blogs on SG2NA

There are no specific blogs for SG2NA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SG2NA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STRN3
Entrez
Uniprot