Recombinant Human SFRS3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SFRS3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-164 of Human SFRS3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SRSF3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00006428-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SFRS3 Protein

  • Pre-mRNA-splicing factor SRP20
  • serine/arginine-rich splicing factor 3
  • SFRS3splicing factor, arginine/serine-rich, 20-kD
  • Splicing factor, arginine/serine-rich 3SRP20
  • SRp20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP2-04142
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-04144
Species: Hu
Applications: WB, IHC-P, IP
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-87993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006428-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SFRS3 Recombinant Protein (H00006428-P01)(2)

Reviews for SFRS3 Recombinant Protein (H00006428-P01) (0)

There are no reviews for SFRS3 Recombinant Protein (H00006428-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SFRS3 Recombinant Protein (H00006428-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SFRS3 Products

Bioinformatics Tool for SFRS3 Recombinant Protein (H00006428-P01)

Discover related pathways, diseases and genes to SFRS3 Recombinant Protein (H00006428-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SFRS3 Recombinant Protein (H00006428-P01)

Discover more about diseases related to SFRS3 Recombinant Protein (H00006428-P01).
 

Pathways for SFRS3 Recombinant Protein (H00006428-P01)

View related products by pathway.

PTMs for SFRS3 Recombinant Protein (H00006428-P01)

Learn more about PTMs related to SFRS3 Recombinant Protein (H00006428-P01).

Blogs on SFRS3

There are no specific blogs for SFRS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SFRS3 Antibody (2D2)
H00006428-M08

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SFRS3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SRSF3