SF3B5 Antibody - Azide and BSA Free

Western Blot: SF3B5 Antibody [NBP2-94370] - Analysis of extracts of various cell lines, using SF3B5 . Exposure time: 90s.

Product Discontinued

SF3B5 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SF3B5 (NP_112577.1). MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SF3B5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 10 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SF3B5 Antibody - Azide and BSA Free

• MGC3133
• Pre-mRNA-splicing factor SF3b 10 kDa subunit
• SF3b10
• SF3b5
• splicing factor 3B subunit 5
• splicing factor 3b, subunit 5, 10kDa
• Ysf3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SF3B5