SETMAR Recombinant Protein Antigen

Images

 
There are currently no images for SETMAR Recombinant Protein Antigen (NBP2-58313PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SETMAR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SETMAR.

Source: E.coli

Amino Acid Sequence: ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL

Protein/Peptide Type
Recombinant Protein Antigen
Gene
SETMAR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58313 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SETMAR Recombinant Protein Antigen

  • EC 2.1.1.43
  • histone-lysine N-methyltransferase SETMAR
  • hsMar1
  • METNASE
  • SET domain and mariner transposase fusion gene
  • SET domain and mariner transposase fusion gene-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85823
Species: Hu
Applications: WB, IHC, IHC-P
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
NB100-79784
Species: Hu, Mu, Rt
Applications: WB, IHC-P, IP
NB100-74602
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-58313PEP
Species: Hu
Applications: AC

Publications for SETMAR Recombinant Protein Antigen (NBP2-58313PEP) (0)

There are no publications for SETMAR Recombinant Protein Antigen (NBP2-58313PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETMAR Recombinant Protein Antigen (NBP2-58313PEP) (0)

There are no reviews for SETMAR Recombinant Protein Antigen (NBP2-58313PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SETMAR Recombinant Protein Antigen (NBP2-58313PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SETMAR Products

Bioinformatics Tool for SETMAR Recombinant Protein Antigen (NBP2-58313PEP)

Discover related pathways, diseases and genes to SETMAR Recombinant Protein Antigen (NBP2-58313PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SETMAR Recombinant Protein Antigen (NBP2-58313PEP)

Discover more about diseases related to SETMAR Recombinant Protein Antigen (NBP2-58313PEP).
 

Pathways for SETMAR Recombinant Protein Antigen (NBP2-58313PEP)

View related products by pathway.

PTMs for SETMAR Recombinant Protein Antigen (NBP2-58313PEP)

Learn more about PTMs related to SETMAR Recombinant Protein Antigen (NBP2-58313PEP).

Blogs on SETMAR

There are no specific blogs for SETMAR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
53BP1 Antibody
NB100-304
53BP1 Antibody
NB100-304
SETMAR Antibody
NBP2-58313
SETMAR Antibody
NBP2-58313
Nbs1 Antibody
NB100-143
Nbs1 Antibody
NB100-143
Nbs1 Antibody
NB100-143

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SETMAR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SETMAR