SET Antibody - BSA Free

Western Blot: SET Antibody [NBP1-58201] - Titration: 2 ug/ml Positive Control: Mouse brain homogenate

Western Blot: SET Antibody [NBP1-58201] - Human Spleen lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SET Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SET(SET nuclear oncogene) The peptide sequence was selected from the N terminal of SET. Peptide sequence IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SET
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SET Antibody - BSA Free

• 2PP2A
• HLA-DR-associated protein II
• I2PP2A
• I-2PP2A
• IGAAD
• Inhibitor of granzyme A-activated DNase
• inhibitor-2 of protein phosphatase-2A
• IPP2A2
• PHAPIITAF-I
• Phosphatase 2A inhibitor I2PP2A
• protein phosphatase type 2A inhibitor
• protein SET
• SET nuclear oncogene
• SET translocation (myeloid leukemia-associated)
• TAF-IBETA
• Template-activating factor I
• Template-Activating Factor-I, chromatin remodelling factor

Background

SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-indu

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SET
• Uniprot:
  • B2RCX0(Human)