SET Antibody (8E8M9)

Western Blot: SET Antibody (8E8M9) [NBP3-16775] - Western blot analysis of extracts of various cell lines, using SET Rabbit mAb (NBP3-16775) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775] - Immunohistochemistry of paraffin-embedded mouse spleen using SET Rabbit mAb (NBP3-16775) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775] - Immunohistochemistry of paraffin-embedded rat brain using SET Rabbit mAb (NBP3-16775) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: SET Antibody (8E8M9) [NBP3-16775] - Immunohistochemistry of paraffin-embedded human esophageal cancer using SET Rabbit mAb (NBP3-16775) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunoprecipitation: SET Antibody (8E8M9) [NBP3-16775] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug SET antibody (NBP3-16775). Western blot was performed from the immunoprecipitate using SET antibody (NBP3-16775) at a dilition of 1:1000.

Immunocytochemistry/ Immunofluorescence: SET Antibody (8E8M9) [NBP3-16775] - Immunofluorescence analysis of U-2 OS cells using SET Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: SET Antibody (8E8M9) [SET] - Immunofluorescence analysis of U-2 OS cells using SET Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clone: 8E8M9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SET Antibody (8E8M9) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human SET (Q01105). ESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SET
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SET Antibody (8E8M9)

• 2PP2A
• HLA-DR-associated protein II
• I2PP2A
• I-2PP2A
• IGAAD
• Inhibitor of granzyme A-activated DNase
• inhibitor-2 of protein phosphatase-2A
• IPP2A2
• PHAPIITAF-I
• Phosphatase 2A inhibitor I2PP2A
• protein phosphatase type 2A inhibitor
• protein SET
• SET nuclear oncogene
• SET translocation (myeloid leukemia-associated)
• TAF-IBETA
• Template-activating factor I
• Template-Activating Factor-I, chromatin remodelling factor

Background

SET is a multi-functional protein involved in apoptosis, transcription, nucleosome assembly, and histone binding. SET was identified as part of a chromosomal rearrangement with NUP214/CAN in acute undifferentiated leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SET