Seryl tRNA synthetase Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human Seryl tRNA synthetase (NP_006504.2).
Sequence: MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SARS1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL.
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
59 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Seryl tRNA synthetase Antibody - BSA Free
Background
Seryl-tRNA synthetase belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC-P, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for Seryl tRNA synthetase Antibody (NBP3-35334) (0)
There are no publications for Seryl tRNA synthetase Antibody (NBP3-35334).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Seryl tRNA synthetase Antibody (NBP3-35334) (0)
There are no reviews for Seryl tRNA synthetase Antibody (NBP3-35334).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Seryl tRNA synthetase Antibody (NBP3-35334) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Seryl tRNA synthetase Products
Research Areas for Seryl tRNA synthetase Antibody (NBP3-35334)
Find related products by research area.
|
Blogs on Seryl tRNA synthetase