Serpin I1/Neuroserpin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Serpin I1/Neuroserpin Antibody [NBP1-82587] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green
Immunohistochemistry-Paraffin: Serpin I1/Neuroserpin Antibody [NBP1-82587] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin I1/Neuroserpin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Serpin I1/Neuroserpin Protein (NBP1-82587PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin I1/Neuroserpin Antibody

  • DKFZp781N13156
  • Neuroserpin
  • Peptidase inhibitor 12
  • PI12
  • PI-12
  • PI12Serpin I1
  • serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1
  • Serpin I1
  • serpin peptidase inhibitor, clade I (neuroserpin), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-57521
Species: Hu
Applications: ICC/IF
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NB100-517
Species: Hu
Applications: WB, ICC/IF, IP
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-80633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97677
Species: Hu, Mu, Rt, Po, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-07799
Species: Hu
NBP1-88354
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82587
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Serpin I1/Neuroserpin Antibody (NBP1-82587) (0)

There are no publications for Serpin I1/Neuroserpin Antibody (NBP1-82587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin I1/Neuroserpin Antibody (NBP1-82587) (0)

There are no reviews for Serpin I1/Neuroserpin Antibody (NBP1-82587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Serpin I1/Neuroserpin Antibody (NBP1-82587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin I1/Neuroserpin Products

Bioinformatics Tool for Serpin I1/Neuroserpin Antibody (NBP1-82587)

Discover related pathways, diseases and genes to Serpin I1/Neuroserpin Antibody (NBP1-82587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin I1/Neuroserpin Antibody (NBP1-82587)

Discover more about diseases related to Serpin I1/Neuroserpin Antibody (NBP1-82587).
 

Pathways for Serpin I1/Neuroserpin Antibody (NBP1-82587)

View related products by pathway.

Blogs on Serpin I1/Neuroserpin

There are no specific blogs for Serpin I1/Neuroserpin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin I1/Neuroserpin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINI1
Entrez