Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINF2. Source: E. coli
Amino Acid Sequence: VPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SERPINF2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90305. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen
Background
Identification in human milk of complexes of matriptase with ATIII, A1AT, or A2AP, provides evidence that the proteolytic activity of matriptase, from cells that express no or low levels of HAI-1, may be controlled by secreted serpins. Sequencing analysis revealed the presence of two alpha2-PI gene variations, both in the second half of exon 10: a frameshift mutation and a G to A transition at nucleotide 11337 in codon 407. Observational study of gene-disease association. (HuGE Navigator). Thrombin activatable fibrinolysis inhibitor and alpha(2)-antiplasmin are not markers for recanalization in patients with ischemic stroke treated with recombinant tissue-type plasminogen activator. Fibrinolysis is amplified by converting alpha-antiplasmin from a plasmin inhibitor to a substrate. Hydroxyethyl starch (HES) dilution enhances fibrinolysis by diminishing alpha2-antiplasmin-plasmin interactions. the Arg6Trp polymorphism may play a significant role in governing the long-term deposition/removal of intravascular fibrin. TAFIa, PAI-1 and alpha-antiplasmin: complementary roles in regulating lysis of thrombi and plasma clots. Alpha2-antiplasmin has an important role in acute pulmonary embolism. Multiple Lys residues within alpha 2-antiplasmin contribute, perhaps in a zipper-like fashion, to its binding to the in-tandem, multikringle array that configures the plasmin heavy chain. alpha2-antiplasmin induction inhibits E-cadherin processing mediated by the plasminogen activator/plasmin system, leading to suppression of progression of oral squamous cell carcinoma via upregulation of cell-cell adhesion
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
Publications for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP) (0)
There are no publications for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP) (0)
There are no reviews for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP) (0)
Additional Serpin F2/alpha 2-Antiplasmin Products
Research Areas for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP)
Find related products by research area.
|
Blogs on Serpin F2/alpha 2-Antiplasmin