Serpin B8/Proteinase Inhibitor 8 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
SERPINB8 (NP_001027018.1, 1 a.a. - 242 a.a.) full-length human protein. MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE |
| Specificity |
SERPINB8 - serpin peptidase inhibitor, clade B (ovalbumin), member 8, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SERPINB8 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Serpin B8/Proteinase Inhibitor 8 Antibody - Azide and BSA Free
Background
Ovalbumin (OVA) is used in variety of laboratories products which contain OVA as a carrier protein. To raise antibodies against small non-immunogenic molecules,called haptens,it is often necessary to couple them to carrier protein,such as OVA.This antibody is a good reagent that may be used for the development of detection assay in ELISA or western blot to test the remaining OVA for clinical products in Vivo or research products In Vitro.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ce, Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for Serpin B8/Proteinase Inhibitor 8 Antibody (H00005271-D01P) (0)
There are no publications for Serpin B8/Proteinase Inhibitor 8 Antibody (H00005271-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Serpin B8/Proteinase Inhibitor 8 Antibody (H00005271-D01P) (0)
There are no reviews for Serpin B8/Proteinase Inhibitor 8 Antibody (H00005271-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Serpin B8/Proteinase Inhibitor 8 Antibody (H00005271-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Serpin B8/Proteinase Inhibitor 8 Products
Research Areas for Serpin B8/Proteinase Inhibitor 8 Antibody (H00005271-D01P)
Find related products by research area.
|
Blogs on Serpin B8/Proteinase Inhibitor 8