Serpin B8/Proteinase Inhibitor 8 Antibody - Azide and BSA Free

Western Blot: Serpin B8/Proteinase Inhibitor 8 Antibody [H00005271-D01P] - Analysis of SERPINB8 expression in transfected 293T cell line by SERPINB8 polyclonal antibody.Lane 1: SERPINB8 transfected lysate(27.70 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Serpin B8/Proteinase Inhibitor 8 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SERPINB8 (NP_001027018.1, 1 a.a. - 242 a.a.) full-length human protein. MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE
• Specificity: SERPINB8 - serpin peptidase inhibitor, clade B (ovalbumin), member 8,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERPINB8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Serpin B8/Proteinase Inhibitor 8 Antibody - Azide and BSA Free

• CAP2
• CAP-2
• CAP2clade B (ovalbumin), member 8
• Cytoplasmic antiproteinase 2
• NK10
• Peptidase inhibitor 8
• PI8
• PI-8
• protease inhibitor 8 (ovalbumin type)
• Serpin B8
• serpin peptidase inhibitor, clade B (ovalbumin), member 8

Background

Ovalbumin (OVA) is used in variety of laboratories products which contain OVA as a carrier protein. To raise antibodies against small non-immunogenic molecules,called haptens,it is often necessary to couple them to carrier protein,such as OVA.This antibody is a good reagent that may be used for the development of detection assay in ELISA or western blot to test the remaining OVA for clinical products in Vivo or research products In Vitro.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERPINB8
• Entrez:
  • 5271(Human)
• Uniprot:
  • NP_001027018.1(Human)